Synthetic peptide within Rat SNAP29 aa 141-190 (internal sequence). The exact sequence is proprietary. (NP_446262).Sequence: QPSSRLKEAINTSKDQESKYQASHPNLRRLHDAELDSVPASTVNTEVYPK Database link: Q9Z2P6 Run BLAST with Run BLAST with
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
SNAP29; synaptosomal-associated protein 29; SNAP-29; golgi SNARE of 32 kDa; synaptosomal-associated protein 29kD; soluble 29 kDa NSF attachment protein; synaptosomal-associated protein, 29kD; vesicle-membrane fusion protein SNAP-29; Gs32; MGC105273;
My Review for Anti-SNAP29 (aa 141-190) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
