SLC6A20 (NP_064593, 301 a.a. ~ 369 a.a) partial recombinant protein with GST tag. The sequence is KATFNYENCLKKVSLLLTNTFDLEDGFLTASNLEQVKGYLASAYPSKYSEMFPQIKNCSL ESELDTAVQ
Conjugate
Unconjugated
Target
Alternative Names
SLC6A20; solute carrier family 6 (proline IMINO transporter), member 20; XT3; SIT1; Xtrp3; sodium- and chloride-dependent transporter XTRP3; orphan transporter XT3; X transporter protein 3; transporter rB21A homolog; sodium/imino-acid transporter 1; neuro
Transport of small hydrophilic substances across cell membranes is mediated by substrate-specific transporter proteins which have been classified into several families of related genes. The protein encoded by this gene is a member of the subgroup of transporter with unidentified substrates within the Na+ and Cl- coupled transporter family. This gene is expressed in kidney, and its alternative splicing generates 2 transcript variants.
Pathway
Amino acid transport across the plasma membrane; SLC-mediated transmembrane transport; Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds.
Citations
Publication ()
Have you cited DPAB-DC2356 in a publication? Let us know and earn a reward for your research.
My Review for Anti-SLC6A20 (aa 301-369) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
