SLC36A2 (NP_861441, 1 a.a. ~ 71 a.a) partial recombinant protein with GST tag. The sequence is MSVTKSTEGPQGAVAIKLDLMSPPESAKKLENKDSTFLDESPSESAGLKKTKGITVFQAL IHLVKGNMGTG
Conjugate
Unconjugated
Target
Alternative Names
SLC36A2; solute carrier family 36 (proton/amino acid symporter), member 2; PAT2; TRAMD1; proton-coupled amino acid transporter 2; tramdorin-1;
This gene encodes a pH-dependent proton-coupled amino acid transporter that belongs to the amino acid auxin permease 1 protein family. The encoded protein primarily transports small amino acids such as glycine, alanine and proline. Mutations in this gene are associated with iminoglycinuria and hyperglycinuria.
Pathway
Amino acid transport across the plasma membrane; SLC-mediated transmembrane transport; Transport of inorganic cations/anions and amino acids/oligopeptides.
Citations
Publication ()
Have you cited DPAB-DC676 in a publication? Let us know and earn a reward for your research.
My Review for Anti-SLC36A2 (aa 1-71) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
