SLC35A2 (NP_005651, 88 a.a. ~ 156 a.a) partial recombinant protein with GST tag. The sequence is AQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQL KILTTALFS
Conjugate
Unconjugated
Target
Alternative Names
SLC35A2; solute carrier family 35 (UDP-galactose transporter), member A2; UGT; CDGX; UGAT; UGT1; UGT2; UGTL; CDG2M; UGALT; UDP-Gal-Tr; UDP-galactose translocator; solute carrier family 35 (UDP-galactose transporter), member 2;
SLC35A2 (solute carrier family 35 (UDP-galactose transporter), member A2) is a protein-coding gene. Diseases associated with SLC35A2 include urogenital tuberculosis, and hepatitis d, and among its related super-pathways are Transmembrane transport of small molecules and Transport of organic anions. GO annotations related to this gene include UDP-galactose transmembrane transporter activity and sugar:hydrogen symporter activity. An important paralog of this gene is SLC35A1.
Pathway
SLC-mediated transmembrane transport; Transport of nucleotide sugars;
Citations
Publication ()
Have you cited DPAB-DC3168 in a publication? Let us know and earn a reward for your research.
My Review for Anti-SLC35A2 (aa 88-156) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
