Specifications
Immunogen
Synthetic peptide corresponding to Human SLC30A7 aa 200-250. Immunogen was conjugated to an immunogenic carrier proteinSequence: HGAAHSHDHAHGHGHFHSHDGPSLKETTGPSRQILQGVFLHILADTLGSI G Database link: Q8NEW0
Applications
Application Notes
IHC-P: 1/300 - 1/2000; WB: 1/300 - 1/2000; IHC-Fr: 1/300 - 1/2000.
Target
Alternative Names
SLC30A7; solute carrier family 30 (zinc transporter), member 7; zinc transporter 7; ZNT7; ZnTL2; zinc transporter ZnT-7; znt-like transporter 2; zinc transporter like 2; solute carrier family 30 member 7; ZnT-7; DKFZp686M0368;
Product Background
Antigen Description
Seems to facilitate zinc transport from the cytoplasm into the Golgi apparatus. Partly regulates cellular zinc homeostasis. Required with ZNT5 for the activation of zinc-requiring enzymes, alkaline phosphatases (ALPs). Transports zinc into the lumens of the Golgi apparatus and the vesicular compartments where ALPs locate, thus, converting apoALPs to holoALPs. Required with ZNT5 and ZNT6 for the activation of TNAP.
Pathway
Diabetes pathways; Disease; Insulin Synthesis and Processing; Metal ion SLC transporters; SLC-mediated transmembrane transport; Transmembrane transport of small molecules; Transport of glucose and other sugars, bile salts and organic acids, metal ions and
Citations
Publication ()
Have you cited DPABH-13714 in a publication?
Let us know and earn a reward for your research.
COA
Loading ......
