Anti-SLC2A9 (aa 224-287) polyclonal antibody

Species Reactivity

Human

Immunogen

SLC2A9 (NP_001001290, 224 a.a. ~ 287 a.a) partial recombinant protein with GST tag. The sequence is PDSPRYLLLEKHNEARAVKAFQTFLGKADVSQEVEEVLAESRVQRSIRLVSVLELLRAPY VRWQ

Conjugate

Alternative Names

SLC2A9; solute carrier family 2 (facilitated glucose transporter), member 9; GLUT9; GLUTX; UAQTL2; URATv1; solute carrier family 2, facilitated glucose transporter member 9; GLUT-9; glucose transporter type 9; human glucose transporter-like protein-9; ura

Entrez Gene ID

UniProt ID

Antigen Description

This gene encodes a member of the SLC2A facilitative glucose transporter family. Members of this family play a significant role in maintaining glucose homeostasis. The encoded protein may play a role in the development and survival of chondrocytes in cartilage matrices. Two transcript variants encoding distinct isoforms have been identified for this gene.

Pathway

Class II GLUTs; SLC-mediated transmembrane transport; Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds;