Anti-SLC2A4 (aa 467-509) polyclonal antibody

Species Reactivity

Human

Immunogen

SLC2A4 (NP_001033, 467 a.a. ~ 509 a.a) partial recombinant protein with GST tag. The sequence is RVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND

Conjugate

Alternative Names

SLC2A4; solute carrier family 2 (facilitated glucose transporter), member 4; GLUT4; solute carrier family 2, facilitated glucose transporter member 4; GLUT-4; insulin-responsive glucose transporter type 4; glucose transporter type 4, insulin-responsive;

Entrez Gene ID

UniProt ID

Antigen Description

This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM).

Pathway

AMPK signaling; AMPK signaling pathway; Adipocytokine signaling pathway; Arf6 trafficking events