SLC25A18 (NP_113669, 124 a.a. ~ 184 a.a) partial recombinant protein with GST tag. The sequence is EMLKIQLQDAGRLAVHHQGSASAPSTSRSYTTGSASTHRRPSATLIAWELLRTQGLAGLY R
Conjugate
Unconjugated
Target
Alternative Names
SLC25A18; solute carrier family 25 (glutamate carrier), member 18; GC2; mitochondrial glutamate carrier 2; GC-2; glutamate/H(+) symporter 2; solute carrier family 25 member 18; solute carrier family 25 (mitochondrial carrier), member 18;
SLC25A18 (solute carrier family 25 (glutamate carrier), member 18) is a protein-coding gene. GO annotations related to this gene include symporter activity. An important paralog of this gene is SLC25A13.
Citations
Publication ()
Have you cited DPAB-DC3437 in a publication? Let us know and earn a reward for your research.
My Review for Anti-SLC25A18 (aa 124-184) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
