SLC22A3 (NP_068812, 90 a.a. ~ 155 a.a) partial recombinant protein with GST tag. The sequence is CQRYLLEAANDSASATSALSCADPLAAFPNRSAPLVPCRGGWRYAQAHSTIVSEFDLVCV NAWMLD
Conjugate
Unconjugated
Target
Alternative Names
SLC22A3; solute carrier family 22 (organic cation transporter), member 3; EMT; EMTH; OCT3; solute carrier family 22 member 3; organic cation transporter 3; EMT organic cation transporter 3; extraneuronal monoamine transporter; solute carrier family 22 (ex
Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. This gene is one of three similar cation transporter genes located in a cluster on chromosome 6. The encoded protein contains twelve putative transmembrane domains and is a plasma integral membrane protein.
My Review for Anti-SLC22A3 (aa 90-155) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
