Synthetic peptide within Human SLC22A14 aa 113-162 (N terminal). The exact sequence is proprietary. (NP_004794).Sequence: AEQLNLTIPQAPNGSFLTCFMYLPVPWNLDSIIQFGLNDTDTCQDGWIYP Database link: Q9Y267
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
SLC22A14; solute carrier family 22, member 14; ORCTL4, organic cationic transporter like 4; solute carrier family 22 (organic cation transporter), member 14; solute carrier family 22 member 14; OCTL2; ORCTL-4; organic cation transporter-like 4; organic ca
SLC22A14 is a member of the organic-cation transporter family. SLC22A14 is a transmembrane protein which is thought to transport small molecules and since this protein is conserved among several species, it is suggested to have a fundamental role in mammalian systems. This gene encodes a member of the organic-cation transporter family.
Citations
Publication ()
Have you cited DPABH-13095 in a publication? Let us know and earn a reward for your research.
My Review for Anti-SLC22A14 (aa 113-162) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
