SLC13A2 (NP_003975, 146 a.a. ~ 220 a.a) partial recombinant protein with GST tag. The sequence is AMMVPIAHAVLDQLHSSQASSNVEEGSNNPTFELQEPSPQKEVTKLDNGQALPVTSASSE GRAHLSQKHLHLTQC
Conjugate
Unconjugated
Target
Alternative Names
SLC13A2; solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2; NaCT; NADC1; SDCT1; NaDC-1; solute carrier family 13 member 2; Na(+)-coupled citrate transporter; Na(+)/dicarboxylate cotransporter 1; renal sodium/dicarboxylate cot
SLC13A2 (solute carrier family 13 (sodium-dependent dicarboxylate transporter), member 2) is a protein-coding gene, and is affiliated with the lncRNA class. Diseases associated with SLC13A2 include diastrophic dysplasia, and metabolic acidosis, and among its related super-pathways are Transmembrane transport of small molecules and Sodium-coupled sulphate, di- and tri-carboxylate transporters. GO annotations related to this gene include low affinity sodium:dicarboxylate symporter activity. An important paralog of this gene is SLC13A5.
Pathway
SLC-mediated transmembrane transport; Transmembrane transport of small molecules.
Citations
Publication ()
Have you cited DPAB-DC3714 in a publication? Let us know and earn a reward for your research.
A: DPAB-DC3714 antibody store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Customer Reviews
My Review for Anti-SLC13A2 (aa 146-220) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
