Anti-SIX4 monoclonal antibody, clone 4C9

Antibody Isotype

IgG1

Clone

4C9

Species Reactivity

Human

Immunogen

Recombinant fragment (proprietary-tag) corresponding to Human SIX homeobox 4 aa 672-781 (C terminal). (NP_059116).Sequence: GQDLLSVPMTQAALGEIVPTAEDQVGHPSPAVHQDFVQEHRLVLQSVANM KENFLSNSESKATSSLMMLDSKSKYVLDGMVDTVCEDLETDKKELAKLQT VQLDEDMQDL Database link: Q9U

Conjugate

Application Notes

IHC-P: 10 μg/ml.

Alternative Names

SIX4; SIX homeobox 4; sine oculis homeobox (Drosophila) homolog 4 , sine oculis homeobox homolog 4 (Drosophila); homeobox protein SIX4; AREC3; sine oculis homeobox homolog 4; MGC119450; MGC119452; MGC119453;

Entrez Gene ID

UniProt ID

Antigen Description

Focal adhesions are actin-rich structures that enable cells to adhere to the extracellular matrix and at which protein complexes involved in signal transduction assemble. Zyxin is a zinc-binding phosphoprotein that concentrates at focal adhesions and along the actin cytoskeleton. Zyxin has an N-terminal proline-rich domain and three LIM domains in its C-terminal half. The proline-rich domain may interact with SH3 domains of proteins involved in signal transduction pathways while the LIM domains are likely involved in protein-protein binding. Zyxin may function as a messenger in the signal transduction pathway that mediates adhesion-stimulated changes in gene expression and may modulate the cytoskeletal organization of actin bundles. Alternative splicing results in multiple transcript variants that encode the same isoform.

Pathway

Transcriptional misregulation in cancer, organism-specific biosystem; Transcriptional misregulation in cancer, conserved biosystem;