Synthetic peptide within SIK3 aa 525-574 (C terminal). The exact sequence is proprietary. Isoform 2Sequence: SDAVLSQSSLMGSQQFQDGENEECGASLGGHEHPDLSDGSQHLNSSCYPS Database link: Q9Y2K2-2 Run BLAST with Run BLAST with
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
SIK3; SIK family kinase 3; serine/threonine-protein kinase SIK3; FLJ12240; KIAA0999; L19; QSK; salt-inducible kinase 3; serine/threonine-protein kinase QSK; SIK-3;
Activated by phosphorylation on Thr 163 by STK11 in complex with STE20 related adapter alpha (STRAD alpha) pseudo kinase and CAB39. Binds to and is activated by YWHAZ when phosphorylated on Thr 163.
Pathway
LKB1 signaling events;
Citations
Publication ()
Have you cited DPABH-12864 in a publication? Let us know and earn a reward for your research.
My Review for Anti-SIK3 (aa 525-574) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
