Anti-SGK223 polyclonal antibody (DPAB-DC687)

Mouse anti-Human SGK223 (aa 2-101) polyclonal antibody for WB, ELISA Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
DKFZp761P0423 (XP_291277, 2 a.a. ~ 101 a.a) partial recombinant protein with GST tag. The sequence is HQTLCLNPESLKMSACSDFVEHIWKPGSCKNCFCLRSDHQLVAGPPQPRAGSLPPPPRLPPRPENCRLEDEGVNSSPYSKPTIAVKPTMMSSEASDVWTE
Conjugate
Unconjugated

Target


Alternative Names
SGK223; PRAGMIN; tyrosine-protein kinase SgK223; sugen kinase 223
Entrez Gene ID
UniProt ID

Citations


Have you cited DPAB-DC687 in a publication? Let us know and earn a reward for your research.

References


Safari, F; Murata-Kamiya, N; et al. Mammalian Pragmin regulates Src family kinases via the Glu-Pro-Ile-Tyr-Ala (EPIYA) motif that is exploited by bacterial effectors. PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA 108:14938-14943(2011).
Leroy, C; Fialin, C; et al. Quantitative Phosphoproteomics Reveals a Cluster of Tyrosine Kinases That Mediates Src Invasive Activity in Advanced Colon Carcinoma Cells. CANCER RESEARCH 69:2279-2286(2009).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-SGK223 polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket