Synthetic peptide within Mouse SF3B5 aa 37-86 (C terminal). The exact sequence is proprietary.Sequence: RDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPSGPPADKPEEN Database link: NP_780311
SF3B5 (splicing factor 3b, subunit 5, 10kDa) is a protein-coding gene. Diseases associated with SF3B5 include gastric cancer, and among its related super-pathways are mRNA Processing and Generic Transcription Pathway.
Pathway
Gene Expression; Processing of Capped Intron-Containing Pre-mRNA; Spliceosome; Spliceosome, U2-snRNP; mRNA Splicing; mRNA Splicing - Major Pathway.
Citations
Publication ()
Have you cited DPABH-27479 in a publication? Let us know and earn a reward for your research.
My Review for Anti-SF3B5 (aa 37-86) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
