Anti-SELK (aa 39-91) polyclonal antibody

Species Reactivity

Human

Immunogen

SELK (NP_067060, 39 a.a. ~ 91 a.a) partial recombinant protein with GST tag. The sequence is KTLLQQDVKKRRSYGNSSDSRYDDGRGPPGNPPRRMGRINHLRGPSPPPMAGG

Conjugate

Alternative Names

SELK; SelK; HSPC030; HSPC297; selenoprotein K;

Entrez Gene ID

UniProt ID

Antigen Description

This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3 UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This selenoprotein is localized to the endoplasmic reticulum and is highly expressed in the heart, where it may function as an antioxidant.

Pathway

Integrated Breast Cancer Pathway; Selenium Pathway;