Rabbit Anti-SCN1A Polyclonal antibody (DPABH-18469)

Rabbit Anti-Human SCN1A Polyclonal antibody for WB, ELISA Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human, Rat
Immunogen
SCN1A fusion protein, sequence: MEAAQQAATATASEHSREPSAAGRLSDSSSEASKLSSKSAKERRNRRKKRKQKEQSGGEEKDEDEFQK (456-522 aa encoded by NM_001165963)
Conjugate
Unconjugated

Applications


Application Notes
WB: 1:500-1:1000
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
SCN1A; sodium channel, voltage gated, type I alpha subunit; FEB3; FHM3; NAC1; SCN1
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-18469 in a publication? Let us know and earn a reward for your research.

References


Rojo, DC; Harvey, AS; et al. Febrile infection-related epilepsy syndrome is not caused by SCN1A mutations. EPILEPSY RESEARCH 100:194-198(2012).
Ishii, A; Kanaumi, T; et al. Association of nonsense mutation in GABRG2 with abnormal trafficking of GABA(A) receptors in severe epilepsy. EPILEPSY RESEARCH 108:420-432(2014).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Rabbit Anti-SCN1A Polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket