Recombinant fragment corresponding to Human RPS5 aa 1-64 (N terminal).Sequence: MTEWETAAPAVAETPDIKLFGKWSTDDVQINDISLQDYIAVKEKYAKYLP HSAGRYAAKRFRKA Database link: P46782
Conjugate
Unconjugated
Applications
Application Notes
IHC-P: 1/50 - 1/200.
Target
Alternative Names
RPS5; ribosomal protein S5; 40S ribosomal protein S5; S5;
RPS5 is a component of the small 40S subunit of ribosomes. The protein belongs to the S7P family of ribosomal proteins and is found in the cytoplasm.
Pathway
Activation of the mRNA upon binding of the cap-binding complex and eIFs, and subsequent binding to 43S; Cap-dependent Translation Initiation; Cytoplasmic Ribosomal Proteins; Disease; Eukaryotic Translation Elongation; Eukaryotic Translation Initiation; Eu
Citations
Publication ()
Have you cited DPABH-14888 in a publication? Let us know and earn a reward for your research.
My Review for Anti-RPS5 (aa 1-64) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
