Anti-RPL32 polyclonal antibody (DPAB-DC2735)

Mouse anti-Human RPL32 (aa 33-132) polyclonal antibody for WB, ELISA

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
RPL32 (NP_000985, 33 a.a. ~ 132 a.a) partial recombinant protein with GST tag. The sequence is RNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLLMCNKSYCAEIAHNVSSKNRKAIVERAAQLAIRVTNPNARLRSE
Conjugate
Unconjugated

Target


Alternative Names
RPL32; ribosomal protein L32; L32; PP9932; 60S ribosomal protein L32
Entrez Gene ID
UniProt ID

Product Background


Pathway
Cap-dependent Translation Initiation; Disease; Eukaryotic Translation Initiation; Formation of a pool of free 40S subunits

Citations


Have you cited DPAB-DC2735 in a publication? Let us know and earn a reward for your research.

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Anti-Mouse IgG Fc polyclonal antibody [HRP] DPAB22321 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] DPAB22315 IF Rabbit PDF Inquiry
Anti-Mouse IgG2a polyclonal antibody [Biotin] DPAB22361 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [Biotin] DPAB22306 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [AP] DPAB22304 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] CPBT-68072GM IHC-Fr FC Goat PDF Inquiry
Anti-Mouse IgG monoclonal antibody, clone OX-20 [FITC] CABT-54559RM FC Rat PDF Inquiry
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


YOGANATHAN, T; BHAT, NK; et al. A POSITIVE REGULATOR OF THE RIBOSOMAL-PROTEIN GENE, BETA-FACTOR, BELONGS TO THE ETS ONCOPROTEIN FAMILY. BIOCHEMICAL JOURNAL 287:349-353(1992).
Rugjee, KN; Chaudhury, SR; et al. Fluorescent protein tagging confirms the presence of ribosomal proteins at Drosophila polytene chromosomes. PEERJ 1:-(2013).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:

Related Products

Related Resources

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

Inquiry Basket