Recombinant fragment corresponding to Human C14orf164 aa 217-293.Sequence: ASTHSLSYRTSSASSGQGIFSFRPSPNGHSGHTRVLTPNNFAQRESTTTL ESLPSFQLPVLQTLYQQRRHMGLPSGR Database link: A8MTL3
Conjugate
Unconjugated
Applications
Application Notes
IHC-P: 1/10 - 1/20;
Target
Alternative Names
RNF212B; ring finger protein 212B; C14orf164; RING finger protein C14orf164; RING finger protein C14orf164-like;
My Review for Anti-RNF212B (aa 217-293) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
