Recombinant protein corresponding to amino acids of recombinant RESP18. The sequence is PTKTTESPLAKVNRDQCFTSEVVSKALKQEVANPVKITYRCSYGGLDMMQAPGPSKEEII YKIMRLLWATS
Conjugate
Unconjugated
Applications
Application Notes
IHC: 1:50-1:200. & The optimal working dilution should be determined by the end user.
Target
Alternative Names
RESP18; regulated endocrine-specific protein 18; regulated endocrine-specific protein 18 homolog;
RESP18 (regulated endocrine-specific protein 18) is a protein-coding gene. Diseases associated with RESP18 include pancreatic cancer, and pancreatitis.
Citations
Publication ()
Have you cited DPAB-DC1814 in a publication? Let us know and earn a reward for your research.
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
