Synthetic peptide within Human RBM43 aa 62-111 (N terminal). The exact sequence is proprietary.Sequence: VAYVIFKEKKVAENVIRQKKHWLARKTRHAELTVSLRVSHFGDKIFSSVN Database link: Q6ZSC3
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
RBM43; RNA binding motif protein 43; C2orf38, chromosome 2 open reading frame 38; RNA-binding protein 43; FLJ45645; RNA-binding motif protein 43; C2orf38;
My Review for Anti-RBM43 (aa 62-111) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
