Synthetic peptide within Human RAB40C aa 227-276 (C terminal). The exact sequence is proprietary.Sequence: MANGMNAVMMHGRSYSLASGAGGGGSKGNSLKRSKSIRPPQSPPQNCSRS Database link: Q96S21
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
RAB40C; RAB40C, member RAS oncogene family; RAS like, family 8, member C; RASL8C; ras-related protein Rab-40C; RARL; RAR like; RAS-like GTPase; rar-like protein; RAR (RAS like GTPASE) like; RAS-like, family 8, member C; SOCS box-containing protein RAR3; r
Probable substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Citations
Publication ()
Have you cited DPABH-13897 in a publication? Let us know and earn a reward for your research.
My Review for Anti-RAB40C (aa 227-276) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
