Anti-PRPH2 polyclonal antibody (DPABH-09704)

Specifications


Host Species
Mouse
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Full length protein corresponding to Human PRPH2 aa 1-346.Sequence: MALLKVKFDQKKRVKLAQGLWLMNWFSVLAGIIIFSLGLFLKIGLRKRSD VMNNSESHFVPNSLIGMGVLSCVFNSLAGKICYDALDPAKYARWKPWLKP YLAICVLFNIILFLVALCCFLLRGSLENTLGQGLKNGMKYYRDTDTPGRC FMKKTIDMLQIEFKCCGNNGFRDWFEIQWISNRY
Conjugate
Unconjugated

Applications


Application Notes
WB: 1 μg/ml.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
PRPH2; peripherin 2 (retinal degeneration, slow); RDS, retinal degeneration, slow; retinal degeneration, slow (retinitis pigmentosa 7); RP7; peripherin-2
Entrez Gene ID
UniProt ID

Product Background


Pathway
Amyotrophic lateral sclerosis (ALS);

Citations


Have you cited DPABH-09704 in a publication? Let us know and earn a reward for your research.

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Anti-Mouse IgG Fc polyclonal antibody [HRP] DPAB22321 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] DPAB22315 IF Rabbit PDF Inquiry
Anti-Mouse IgG2a polyclonal antibody [Biotin] DPAB22361 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [Biotin] DPAB22306 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [AP] DPAB22304 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] CPBT-68072GM IHC-Fr FC Goat PDF Inquiry
Anti-Mouse IgG monoclonal antibody, clone OX-20 [FITC] CABT-54559RM FC Rat PDF Inquiry
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Moritz, OL; Peck, A; et al. Xenopus laevis red cone opsin and Prph2 promoters allow transgene expression in amphibian cones, or both rods and cones. GENE 298:173-182(2002).
Lakowski, J; Han, YT; et al. Effective Transplantation of Photoreceptor Precursor Cells Selected Via Cell Surface Antigen Expression. STEM CELLS 29:1391-1404(2011).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:
Verification code
Click image to refresh the verification code.

Related Products

Related Resources

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

Inquiry Basket