Anti-PRKAG1 monoclonal antibody, clone 8I4F0

Antibody Isotype

IgG1

Clone

8I4F0

Species Reactivity

Human

Immunogen

Recombinant fragment corresponding to Human AMPK gamma 1 aa 230-331. (Expressed in E.coli).Sequence: VVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKC YLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEK KP Database link: P54619

Conjugate

Application Notes

ICC/IF: 1/200 - 1/1000; Flow Cyt: 1/200 - 1/400; IHC-P: 1/200 - 1/1000; WB: 1/500 - 1/2000.

Alternative Names

PRKAG1; protein kinase, AMP-activated, gamma 1 non-catalytic subunit; 5-AMP-activated protein kinase subunit gamma-1; AMPK gamma1; AMPK gamma-1 chain; 5-AMP-activated protein kinase, gamma-1 subunit; AMPKG; MGC8666;

Entrez Gene ID

UniProt ID

Antigen Description

AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Gamma non-catalytic subunit mediates binding to AMP, ADP and ATP, leading to activate or inhibit AMPK: AMP-binding results in allosteric activation of alpha catalytic subunit (PRKAA1 or PRKAA2) both by inducing phosphorylation and preventing dephosphorylation of catalytic subunits. ADP also stimulates phosphorylation, without stimulating already phosphorylated catalytic subunit. ATP promotes dephosphorylation of catalytic subunit, rendering the AMPK enzyme inactive.

Pathway

AMPK signaling, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Energy Metabolism, organism-specific biosystem; Energy dependent regulation of mTOR by LKB1-AMPK, organism-specific biosystem; Hypertrophic cardiomyopathy (HCM), organism-specific biosystem; Hypertrophic cardiomyopathy (HCM), conserved biosystem;