Recombinant fragment corresponding to Human Protein Phosphatase 1 beta aa 189-279.Sequence: MRPTDVPDTGLLCDLLWSDPDKDVQGWGENDRGVSFTFGADVVSKFLNRH DLDLICRAHQVVEDGYEFFAKRQLVTLFSAPN YCGEFDNAGDatabase link: BC002697
Conjugate
Unconjugated
Applications
Application Notes
WB: 1/500 - 1/1000; IHC-P: 1/100 - 1/500;
Target
Alternative Names
PPP1CB; protein phosphatase 1, catalytic subunit, beta isozyme; PP1B; PP-1B; PPP1CD; PP1beta; HEL-S-80p; serine/threonine-protein phosphatase PP1-beta catalytic subunit; protein phosphatase 1-beta; protein phosphatase 1-delta; epididymis secretory sperm b
Protein phosphatase (PP1) is essential for cell division, it participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Involved in regulation of ionic conductances and long-term synaptic plasticity. Component of the PTW/PP1 phosphatase complex, which plays a role in the control of chromatin structure and cell cycle progression during the transition from mitosis into interphase.
Pathway
Adrenergic signaling in cardiomyocytes; Alcoholism; Amphetamine addiction; Cell Cycle
Citations
Publication ()
Have you cited DPABH-08373 in a publication? Let us know and earn a reward for your research.
My Review for Anti-PPP1CB (aa 189-279) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
