PPIL4 (NP_624311, 395 a.a. ~ 466 a.a) partial recombinant protein with GST tag. The sequence is EKEDEDYMPIKNTNQDIYREMGFGHYEEEESCWEKQKSEKRDRTQNRSRSRSRERDGHYS NSHKSKYQTDLY
Conjugate
Unconjugated
Target
Alternative Names
PPIL4; peptidylprolyl isomerase (cyclophilin)-like 4; HDCME13P; peptidyl-prolyl cis-trans isomerase-like 4; PPIase; rotamase PPIL4; cyclophilin-like protein PPIL4; cyclophilin-type peptidyl-prolyl cis-trans isomerase; serologically defined breast cancer a
This gene is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions.
Citations
Publication ()
Have you cited DPAB-DC3558 in a publication? Let us know and earn a reward for your research.
My Review for Anti-PPIL4 (aa 395-466) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
