POU3F2 (NP_005595, 1 a.a. ~ 67 a.a) partial recombinant protein with GST tag. The sequence is MATAASNHYSLLTSSASIVHAEPPGGMQQGAGGYREAQSLVQGDYGALQSNGHPLSHAHQ WITALSH
Conjugate
Unconjugated
Target
Alternative Names
POU3F2; POU class 3 homeobox 2; BRN2; OCT7; OTF7; OTF-7; POUF3; brn-2; oct-7; N-Oct3; POU domain, class 3, transcription factor 2; brain-2; octamer-binding protein 7; octamer-binding transcription factor 7; brain-specific homeobox/POU domain protein 2; ne
This gene encodes a member of the POU-III class of neural transcription factors. The encoded protein is involved in neuronal differentiation and enhances the activation of corticotropin-releasing hormone regulated genes. Overexpression of this protein is associated with an increase in the proliferation of melanoma cells.
Pathway
SIDS Susceptibility Pathways.
Citations
Publication ()
Have you cited DPAB-DC2335 in a publication? Let us know and earn a reward for your research.
My Review for Anti-POU3F2 (aa 1-67) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
