Anti-PLP1 (aa 177-232) polyclonal antibody

Species Reactivity

Human

Immunogen

PLP1 (NP_000524, 177 a.a. ~ 232 a.a) partial recombinant protein with GST tag. The sequence is YFNTWTTCQSIAFPSKTSASIGSLCADARMYGVLPWNAFPGKVCGSNLLSICKTAE

Conjugate

Alternative Names

PLP1; proteolipid protein 1; PLP; PMD; HLD1; MMPL; SPG2; GPM6C; PLP/DM20; myelin proteolipid protein; lipophilin; major myelin proteolipid protein;

Entrez Gene ID

UniProt ID

Antigen Description

This gene encodes a transmembrane proteolipid protein that is the predominant myelin protein present in the central nervous system. It may play a role in the compaction, stabilization, and maintenance of myelin sheaths, as well as in oligodendrocyte development and axonal survival. Mutations in this gene cause X-linked Pelizaeus-Merzbacher disease and spastic paraplegia type 2. Alternatively spliced transcript variants encoding distinct isoforms or having different 5 UTRs, have been identified for this gene.

Pathway

Glial Cell Differentiation;