Anti-PLOD1 polyclonal antibody (DPAB-DC2279)

Mouse anti-Human PLOD1 (aa 19-114) polyclonal antibody for WB, ELISA Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
PLOD1 (NP_000293, 19 a.a. ~ 114 a.a) partial recombinant protein with GST tag. The sequence is KGDAKPEDNLLVLTVATKETEGFRRFKRSAQFFNYKIQALGLGEDWNVEKGTSAGGGQKVRLLKKALEKHADKEDLVILFADSYDVLFASGPRELL
Conjugate
Unconjugated

Target


Alternative Names
PLOD1; procollagen-lysine, 2-oxoglutarate 5-dioxygenase 1; LH; LH1; LLH; EDS6
Entrez Gene ID
UniProt ID

Product Background


Pathway
Collagen biosynthesis and modifying enzymes; Extracellular matrix organization; Lysine degradation;

Citations


Have you cited DPAB-DC2279 in a publication? Let us know and earn a reward for your research.

References


Flister, MJ; Tsaih, SW; et al. Identifying multiple causative genes at a single GWAS locus. GENOME RESEARCH 23:1996-2002(2013).
Ganga, M; Espinoza, HM; et al. PITX2 isoform-specific regulation of atrial natriuretic factor expression - Synergism and repression with Nkx2.5. JOURNAL OF BIOLOGICAL CHEMISTRY 278:22437-22445(2003).

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-PLOD1 polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket