Anti-PLOD1 polyclonal antibody (DPAB-DC2279)

Mouse anti-Human PLOD1 (aa 19-114) polyclonal antibody for WB, ELISA Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
PLOD1 (NP_000293, 19 a.a. ~ 114 a.a) partial recombinant protein with GST tag. The sequence is KGDAKPEDNLLVLTVATKETEGFRRFKRSAQFFNYKIQALGLGEDWNVEKGTSAGGGQKVRLLKKALEKHADKEDLVILFADSYDVLFASGPRELL
Conjugate
Unconjugated

Target


Alternative Names
PLOD1; procollagen-lysine, 2-oxoglutarate 5-dioxygenase 1; LH; LH1; LLH; EDS6
Entrez Gene ID
UniProt ID

Product Background


Pathway
Collagen biosynthesis and modifying enzymes; Extracellular matrix organization; Lysine degradation;

Citations


Have you cited DPAB-DC2279 in a publication? Let us know and earn a reward for your research.

References


Cox, CJ; Espinoza, HM; et al. Differential regulation of gene expression by PITX2 isoforms. JOURNAL OF BIOLOGICAL CHEMISTRY 277:25001-25010(2002).
Li, XP; Kim, SW; et al. Analyses of porcine public SNPs in coding-gene regions by re-sequencing and phenotypic association studies. MOLECULAR BIOLOGY REPORTS 38:3805-3820(2011).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-PLOD1 polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket