Anti-PLCD1 polyclonal antibody (DPAB-DC2266)

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
PLCD1 (AAH50382, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. The sequence is MDSGRDFLTLHGLQDDEDLQALLKGSQLLKVKSSSWRRERFYKLQEDCKTIWQESRKVMRTPESQLFSIEDIQEVRMGHRTEGLEKFARDVPEDRCFSIV
Conjugate
Unconjugated

Target


Alternative Names
PLCD1; phospholipase C, delta 1; NDNC3; PLC-III; 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1; PLC-delta-1
Entrez Gene ID
UniProt ID

Product Background


Pathway
Calcium signaling pathway; D-myo-inositol (1,4,5)-trisphosphate biosynthesis; D-myo-inositol-5-phosphate metabolism; Inositol phosphate metabolism

Citations


Have you cited DPAB-DC2266 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Huque, T; Cowart, BJ; et al. Sour Ageusia in Two Individuals Implicates Ion Channels of the ASIC and PKD Families in Human Sour Taste Perception at the Anterior Tongue. PLOS ONE 4:-(2009).
NOMOTO, K; TOMITA, N; et al. EXPRESSION OF PHOSPHOLIPASES GAMMA-1, BETA-1, AND DELTA-1 IN PRIMARY HUMAN COLON CARCINOMAS AND COLON-CARCINOMA CELL-LINES. MOLECULAR CARCINOGENESIS 12:146-152(1995).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket