Anti-PLA2G6 monoclonal antibody, clone 21B3

Antibody Isotype

IgG2a

Clone

21B3

Species Reactivity

Human

Immunogen

Recombinant fragment corresponding to Human Calcium-independent Phospholipase A2 aa 490-752. Produced in E.coli (NP_001004426).Sequence: MKDEVFRGSRPYESGPLEEFLKREFGEHTKMTDVRKPKVMLTGTLSDRQP AELHLFRNYDAPETVREPRFNQNVNLRPPAQPSDQLVWRAARSSGAAPTY FRPNGRFLDGGLLANN

Conjugate

Application Notes

WB: 1/500;

Alternative Names

PLA2G6; phospholipase A2, group VI (cytosolic, calcium-independent); 85 kDa calcium-independent phospholipase A2; iPLA2; PARK14; PNPLA9; GVI PLA2; group VI phospholipase A2; calcium-independent phospholipase A2; patatin-like phospholipase domain containin

Entrez Gene ID

UniProt ID

Antigen Description

Catalyzes the release of fatty acids from phospholipids. It has been implicated in normal phospholipid remodeling, nitric oxide-induced or vasopressin-induced arachidonic acid release and in leukotriene and prostaglandin production. May participate in fas mediated apoptosis and in regulating transmembrane ion flux in glucose-stimulated B-cells. Has a role in cardiolipin (CL) deacylation. Required for both speed and directionality of monocyte MCP1/CCL2-induced chemotaxis through regulation of F-actin polymerization at the pseudopods.Isoform ankyrin-iPLA2-1 and isoform ankyrin-iPLA2-2, which lack the catalytic domain, are probably involved in the negative regulation of iPLA2 activity.

Pathway

Arachidonic acid metabolism, organism-specific biosystem; Arachidonic acid metabolism, conserved biosystem; Eicosanoid Synthesis, organism-specific biosystem; Ether lipid metabolism, organism-specific biosystem; Ether lipid metabolism, conserved biosystem; Fat digestion and absorption, organism-specific biosystem; Fat digestion and absorption, conserved biosystem;