Recombinant protein corresponding to amino acids of recombinant PHLDB3. The sequence is RQQREQEQRRLSQERDRLEGLRQRLRKAQGQLDSQPEDQRERLLQGVQEMREQLDVAQRA YEDLEFQ
Conjugate
Unconjugated
Applications
Application Notes
IHC: 1:200-1:500; IF: 1-4 μg/mL. & The optimal working dilution should be determined by the end user.
Target
Alternative Names
PHLDB3; pleckstrin homology-like domain, family B, member 3; pleckstrin homology-like domain family B member 3;
PHLDB3 (pleckstrin homology-like domain, family B, member 3) is a protein-coding gene. GO annotations related to this gene include phospholipid binding. An important paralog of this gene is PHLDB1.
Citations
Publication ()
Have you cited DPAB-DC2898 in a publication? Let us know and earn a reward for your research.
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
