Anti-PGK2 (aa 268-339) polyclonal antibody

Species Reactivity

Human

Immunogen

PGK2 (NP_620061, 268 a.a. ~ 339 a.a) partial recombinant protein with GST tag. The sequence is DIMAKAQKNGVRITFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQV VAQARLIVWNGP

Conjugate

Alternative Names

PGK2; phosphoglycerate kinase 2; PGKB; PGKPS; HEL-S-272; dJ417L20.2; epididymis secretory protein Li 272; phosphoglycerate kinase, testis specific; phosphoglycerate kinase autosomal pseudogene;

Entrez Gene ID

UniProt ID

Antigen Description

This gene is intronless, arose via retrotransposition of the phosphoglycerate kinase 1 gene, and is expressed specifically in the testis. Initially assumed to be a pseudogene, the encoded protein is actually a functional phosphoglycerate kinase that catalyzes the reversible conversion of 1,3-bisphosphoglycerate to 3-phosphoglycerate, during the Embden-Meyerhof-Parnas pathway of glycolysis, in the later stages of spermatogenesis.[provided by RefSeq, May 2010]

Pathway

Biosynthesis of amino acids; Carbon metabolism; Gluconeogenesis, oxaloacetate => Gluconeogenesis, oxaloacetate =>