Synthetic peptide within Human PET112L aa 33-82 (N terminal). The exact sequence is proprietary.Sequence: GSTSNQIRGESSVAQQPLHTAQKTRKGEHKWAAVVGLEIHAQISSNSKLF Database link: O75879
Furnishes a means for formation of correctly charged Gln-tRNA(Gln) through the transamidation of misacylated Glu-tRNA(Gln) in the mitochondria. The reaction takes place in the presence of glutamine and ATP through an activated gamma-phospho-Glu-tRNA(Gln).
Pathway
Aminoacyl-tRNA biosynthesis;
Citations
Publication ()
Have you cited DPABH-14103 in a publication? Let us know and earn a reward for your research.
My Review for Anti-PET112 (aa 33-82) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
