Anti-PACSIN2 polyclonal antibody (DPABH-09995)

Rabbit Anti-Human PACSIN2 (full length) polyclonal antibody for WB

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Full length protein corresponding to Human PACSIN2 aa 1-486.Sequence: MSVTYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCSDLMNCLHERAR IEKAYAQQLTEWARRWRQLVEKGPQYGTVEKAWMAFMSEAERVSELHLEV KASLMNDDFEKIKNWQKEAFHKQMMGGFKETKEAEDGFRKAQKPWAKKLK EVEAAKKAHHAACKEEKLAISREANSKADPSL
Conjugate
Unconjugated

Applications


Application Notes
WB: 1 μg/ml.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
PACSIN2; protein kinase C and casein kinase substrate in neurons 2; protein kinase C and casein kinase substrate in neurons protein 2; SDPII; syndapin II; cytoplasmic phosphoprotein PACSIN2
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-09995 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Caron, NS; Desmond, CR; et al. Polyglutamine domain flexibility mediates the proximity between flanking sequences in huntingtin. PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES OF THE UNITED STATES OF AMERICA 110:14610-14615(2013).
Wakamatsu, M; Ishii, A; et al. Accumulation of phosphorylated alpha-synuclein in dopaminergic neurons of transgenic mice that express human alpha-synuclein. JOURNAL OF NEUROSCIENCE RESEARCH 85:1819-1825(2007).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:

Related Products

Related Resources

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

Inquiry Basket