Rabbit Anti-OXSM Polyclonal antibody (DPABH-23181)

Rabbit Anti-Human OXSM Polyclonal antibody for WB, IHC, ELISA Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human, Mouse, Rat
Immunogen
OXSM fusion protein, sequence: VSETALNFQTKGYNKVSPFFVPKILVNMAAGQVSIRYKLKGPNHAVSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSLAGFSRARALSTNSDPKLACRPFHPKRDGFVMGEGAAVLVLEEYEHAVQRRARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQPEEISYINAHATSTPLGDAAENKAIKHLFKDHAYALAVSSTKGATGHLLGAAGAVEAAFTTLACYYQKLPPTLNLDCSEPEFDLNYVPLKAQEWKTEKRFIGLTNSFGFGGTNATLCIAGL (160-459 aa encoded by BC008202)
Conjugate
unconjugated

Applications


Application Notes
WB: 1:500-1:3000
IHC: 1:100-1:400
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
OXSM; 3-oxoacyl-ACP synthase, mitochondrial; KS; KASI; FASN2D; 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-23181 in a publication? Let us know and earn a reward for your research.

References


Gurvitz, A; et al. Identification of the Leishmania major Proteins LmjF07.0430, LmjF07.0440, and LmjF27.2440 as Components of Fatty Acid Synthase II. JOURNAL OF BIOMEDICINE AND BIOTECHNOLOGY :-(2009).
Gurvitz, A; et al. The essential mycobacterial genes, fabG1 and fabG4, encode 3-oxoacyl-thioester reductases that are functional in yeast mitochondrial fatty acid synthase type 2. MOLECULAR GENETICS AND GENOMICS 282:407-416(2009).

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Rabbit Anti-OXSM Polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket