OR2A42 (NP_001001802, 35 a.a. ~ 94 a.a) partial recombinant protein with GST tag. The sequence is NGAILGLISLDSRLHTPMYFFLSHLAVVDIAYTRNTVPQMLANLLHPAKPISFAGCMTQT
Conjugate
Unconjugated
Target
Alternative Names
OR2A42; olfactory receptor, family 2, subfamily A, member 42; olfactory receptor 2A1/2A42; olfactory receptor OR7-16; olfactory receptor OR7-19;
Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms.
Pathway
GPCR downstream signaling; Olfactory transduction; Signal Transduction.
Citations
Publication ()
Have you cited DPAB-DC1868 in a publication? Let us know and earn a reward for your research.
My Review for Anti-OR2A42 (aa 35-94) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
