Synthetic peptide corresponding to a region within the N terminal amino acids 2-51 (SKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTY V) of Human NR2E1/ Tailless (NP_003260).
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
NR2E1; nuclear receptor subfamily 2, group E, member 1; TLL; TLX; XTLL; nuclear receptor subfamily 2 group E member 1; tailless homolog; nuclear receptor TLX; tailes-related receptor; protein tailless homolog;
Orphan receptor that binds DNA as a monomer to hormone response elements (HRE) containing an extended core motif half-site sequence 5-AAGGTCA-3 in which the 5 flanking nucleotides participate in determining receptor specificity. May be required for brain development. May be involved in the regulation of retinal development.
My Review for Anti-NR2E1 (aa 2-51) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
