Anti-NMUR1 (aa 2-68) polyclonal antibody

Species Reactivity

Human

Immunogen

NMUR1 (NP_006047, 2 a.a. ~ 68 a.a) partial recombinant protein with GST tag. The sequence is TPLCLNCSVLPGDLYPGGARNPMACNGSAARGHFDPEDLNLTDEALRLKYLGPQQTELFM PICATYL

Conjugate

Alternative Names

NMUR1; neuromedin U receptor 1; FM3; FM-3; GPC-R; GPR66; NMU1R; (FM-3); neuromedin-U receptor 1; NMU-R1; G protein-coupled receptor 66; G-protein coupled receptor 66; G-protein coupled receptor FM-3;

Entrez Gene ID

UniProt ID

Antigen Description

NMUR1 (neuromedin U receptor 1) is a protein-coding gene. Diseases associated with NMUR1 include eating disorder, and hypertension, and among its related super-pathways are Class A/1 (Rhodopsin-like receptors) and Signaling by GPCR. GO annotations related to this gene include neuromedin U receptor activity and G-protein coupled receptor activity. An important paralog of this gene is GHSR.

Pathway

Class A/1 (Rhodopsin-like receptors); G alpha (q) signalling events; GPCR ligand binding; Gastrin-CREB signalling pathway via PKC and MAPK