Recombinant fragment corresponding to Human Naked1 aa 181-254.Sequence: LRVKLTVAPDGSQSKRSVLVNQADLQSARPRAETKPTEDLRSWEKKQRAP LRFQGDSRLEQSGCYHHCVDENIE Database link: Q969G9
Naked1 (Nkd1) is a homologue of Drosophila Naked cuticle, a negative regulator of Wnt/Wingless signaling pathway. Naked proteins contain a putative calcium-binding EF-hand motif; however, Drosophila Naked binds to zinc instead of calcium. Naked inhibits the canonical Wnt/β-catenin pathway by binding to Dishevelled proteins and directs Dishevelled activity towards the planar cell polarity pathway. Naked1 is a direct target of Wnt signaling and is overexpressed in some colon tumors due to constitutive activation of Wnt/β-catenin pathway.
Pathway
Hippo signaling pathway; Presenilin action in Notch and Wnt signaling; Wnt Signaling Pathway and Pluripotency; Wnt signaling pathway
Citations
Publication ()
Have you cited DPABH-14713 in a publication? Let us know and earn a reward for your research.
My Review for Anti-NKD1 (aa 181-254) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
