Anti-NFASC polyclonal antibody (DPAB-DC1050)

Mouse anti-Human NFASC (aa 661-758) polyclonal antibody for WB, ELISA

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
NFASC (NP_001005388, 661 a.a. ~ 758 a.a) partial recombinant protein with GST tag. The sequence is KDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDRPRDLELTDLAERSVRLTWIPGDANNS
Conjugate
Unconjugated

Target


Alternative Names
NFASC; neurofascin; NF; NRCAML; neurofascin homolog
Entrez Gene ID
UniProt ID

Product Background


Pathway
Axon guidance; Developmental Biology; L1CAM interactions;

Citations


Have you cited DPAB-DC1050 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Anti-Mouse IgG Fc polyclonal antibody [HRP] DPAB22321 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] DPAB22315 IF Rabbit PDF Inquiry
Anti-Mouse IgG2a polyclonal antibody [Biotin] DPAB22361 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [Biotin] DPAB22306 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [AP] DPAB22304 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] CPBT-68072GM IHC-Fr FC Goat PDF Inquiry
Anti-Mouse IgG monoclonal antibody, clone OX-20 [FITC] CABT-54559RM FC Rat PDF Inquiry
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Davis, JQ; Lambert, S; et al. Molecular composition of the node of Ranvier: Identification of ankyrin-binding cell adhesion molecules neurofascin (Mucin+ third FNIII domain-) and NrCAM at nodal axon segments. JOURNAL OF CELL BIOLOGY 135:1355-1367(1996).
Derfuss, T; Direskeneli, GS; et al. Autoantigen- and Pathogen-Specific T- and B-Cell Responses in Multiple Sclerosis: A Never-Ending Story?. AKTUELLE NEUROLOGIE 35:345-355(2008).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:
Verification code
Click image to refresh the verification code.

Related Products

Related Resources

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

Inquiry Basket