NDUFB1 (AAH09691, 1 a.a. ~ 58 a.a) full-length recombinant protein with GST tag. The sequence is MVNLLQIVRDHWAHVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK
NDUFB1 (NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 1, 7kDa) is a protein-coding gene. Diseases associated with NDUFB1 include huntington's disease, and parkinson's disease, and among its related super-pathways are Electron Transport Chain and Metabolic pathways. GO annotations related to this gene include NADH dehydrogenase (ubiquinone) activity.
Pathway
Alzheimers disease; Electron Transport Chain; Huntingtons disease; NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Citations
Publication ()
Have you cited DPAB-DC2003 in a publication? Let us know and earn a reward for your research.
My Review for Anti-NDUFB1 (full length) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
