NAGK (NP_060037, 1 a.a. ~ 69 a.a) partial recombinant protein with GST tag. The sequence is MAAIYGGVEGGGTRSEVLLVSEDGKILAEADGLSTNHWLIGTDKCVERINEMVNRAKRKA GVDPLVPLR
This gene encodes a member of the N-acetylhexosamine kinase family. The encoded protein catalyzes the conversion of N-acetyl-D-glucosamine to N-acetyl-D-glucosamine 6-phosphate, and is the major mammalian enzyme which recovers amino sugars.
Pathway
Amino sugar and nucleotide sugar metabolism; N-acetylglucosamine degradation II;
Citations
Publication ()
Have you cited DPAB-DC2417 in a publication? Let us know and earn a reward for your research.
My Review for Anti-NAGK (aa 1-69) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
