Anti-MS4A2 (aa 1-59) polyclonal antibody

Species Reactivity

Human

Immunogen

MS4A2 (NP_000130, 1 a.a. ~ 59 a.a) partial recombinant protein with GST tag. The sequence is MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQE

Conjugate

Alternative Names

MS4A2; membrane-spanning 4-domains, subfamily A, member 2; APY; IGEL; IGER; ATOPY; FCERI; IGHER; MS4A1; FCER1B; high affinity immunoglobulin epsilon receptor subunit beta; igE Fc receptor subunit beta; high affinity IgE receptor beta subunit; immunoglobul

Entrez Gene ID

UniProt ID

Antigen Description

The allergic response involves the binding of allergen to receptor-bound IgE followed by cell activation and the release of mediators responsible for the manifestations of allergy. The IgE-receptor, a tetramer composed of an alpha, beta, and 2 disulfide-linked gamma chains, is found on the surface of mast cells and basophils. This gene encodes the beta subunit of the high affinity IgE receptor which is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member is localized to 11q12, among a cluster of membrane-spanning 4A gene family members. Alternative splicing results in multiple transcript variants encoding distinct proteins. Additional transcript variants have been described but require experimental validation.

Pathway

Asthma; Fc epsilon RI signaling pathway; Fc epsilon receptor (FCERI) signaling; Immune System