Synthetic peptide within Human Allergin 1 aa 253-302 (C terminal). The exact sequence is proprietary. NP_001078892Sequence: KTRKAMRNNVPRDRGDTAMEVGIYANILEKQAKEESVPEVGSRPCVSTAQ Database link: Q7Z6M3
Immunoglobulin-like receptor which plays an inhibitory role in degranulation of mast cells. Negatively regulates IgE-mediated mast cell activation and suppresses the type I immediate hypersensitivity reaction.
Citations
Publication ()
Have you cited DPABH-12523 in a publication? Let us know and earn a reward for your research.
My Review for Anti-MILR1 (aa 253-302) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
