Recombinant fragment corresponding to Human Malignant fibrous histiocytoma aa 974-1050.Sequence: PGLHYTVHILCSKCLKRGSPNPHAFPGELLSQPRPEGVAEIICPKNGSER VNVALVYPPTPTVISPCSKKNVGEKHR Database link: Q9Y4C4
This gene encodes a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo. Two transcript variants encoding two different isoforms have been found for this gene.
Citations
Publication ()
Have you cited DPABH-14777 in a publication? Let us know and earn a reward for your research.
My Review for Anti-MFHAS1 (aa 974-1050) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
