MARCKS (NP_002347, 2 a.a. ~ 65 a.a) partial recombinant protein with GST tag. The sequence is GAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQAN GSAP
Conjugate
Unconjugated
Target
Alternative Names
MARCKS; myristoylated alanine-rich protein kinase C substrate; MACS; 80K-L; PKCSL; PRKCSL; myristoylated alanine-rich C-kinase substrate; phosphomyristin; protein kinase C substrate, 80 kDa protein, light chain; myristoylated alanine-rich protein kinase C
The protein encoded by this gene is a substrate for protein kinase C. It is localized to the plasma membrane and is an actin filament crosslinking protein. Phosphorylation by protein kinase C or binding to calcium-calmodulin inhibits its association with actin and with the plasma membrane, leading to its presence in the cytoplasm. The protein is thought to be involved in cell motility, phagocytosis, membrane trafficking and mitogenesis.
Pathway
Acetylcholine regulates insulin secretion; Fc gamma R-mediated phagocytosis; Integration of energy metabolism; MicroRNAs in cancer
Citations
Publication ()
Have you cited DPAB-DC1883 in a publication? Let us know and earn a reward for your research.
My Review for Anti-MARCKS (aa 2-65) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
