Synthetic peptide within Human MAP3K4 aa 75-125. The exact sequence is proprietary. (NP_005913.2).Sequence: TNTENLYGTSPPSTPRQMKRMSTKHQRNNVGRPASRSNLKEKMNAPNQPP H Database link: Q9Y6R4
Conjugate
Unconjugated
Applications
Application Notes
WB: 1/2000 - 1/10000; IP: 2-10 μg/mg.
Target
Alternative Names
MAP3K4; mitogen-activated protein kinase kinase kinase 4; MEKK4; KIAA0213; MAPKKK4; MTK1; MEKK 4; MEK kinase 4; MAP three kinase 1; MAP/ERK kinase kinase 4; MAPK/ERK kinase kinase 4; predicted protein of HQ0412; SSK2/SSK22 MAP kinase kinase kinase, yeast,
Component of a protein kinase signal transduction cascade. Activates the CSBP2, P38 and JNK MAPK pathways, but not the ERK pathway. Specifically phosphorylates and activates MAP2K4 and MAP2K6.
My Review for Anti-MAP3K4 (aa 75-125) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
