Recombinant fragment corresponding to Human MAK16 aa 104-193 (internal sequence).Sequence: FIRHKCKQRFTKITQYLIRIRKLTLKRQRKLVPLSKKVERREKRREEKAL IAAQLDNAIEKELLERLKQDTYGDIYNFPIHAFDKALEQQ Database link: Q9BXY0
Conjugate
Unconjugated
Applications
Application Notes
IHC-P: 1/2500 - 1/5000.
Target
Alternative Names
MAK16; MAK16 homolog (S. cerevisiae); RBM13, RNA binding motif protein 13; protein MAK16 homolog; MAK16L; NNP78; RNA binding protein; RNA binding motif protein 13; RBM13;
My Review for Anti-MAK16 (aa 104-193) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
